Analysis of antimicrobial and immunomodulatory substances produced by heterofermentative Lactobacillus reuteri
Sign Up to like & getrecommendations! Published in 2017 at "Folia Microbiologica"
DOI: 10.1007/s12223-017-0524-9
Abstract: Antimicrobial and immunomodulatory potential of various Lactobacillus reuteri strains is closely connected to their metabolite production profile under given cultivation conditions. We determined the in vitro production of antimicrobial substances such as organic acids, ethanol,… read more here.
Keywords: production; antimicrobial immunomodulatory; lactobacillus reuteri; reuteri ... See more keywords
A Frog-Derived Cathelicidin Peptide with Dual Antimicrobial and Immunomodulatory Activities Effectively Ameliorates Staphylococcus aureus-Induced Peritonitis in Mice.
Sign Up to like & getrecommendations! Published in 2022 at "ACS infectious diseases"
DOI: 10.1021/acsinfecdis.2c00260
Abstract: As antimicrobial resistance poses an increasing threat to public health, it is urgent to develop new antimicrobial agents. In this paper, we identify a novel 30-residue peptide (Nv-CATH, NCNFLCKVKQRLRSVSSTSHIGMAIPRPRG) from the skin of the frog… read more here.
Keywords: antimicrobial immunomodulatory; staphylococcus aureus; cath; mice ... See more keywords
From Petri Dish to Patient: Bioavailability Estimation and Mechanism of Action for Antimicrobial and Immunomodulatory Natural Products
Sign Up to like & getrecommendations! Published in 2019 at "Frontiers in Microbiology"
DOI: 10.3389/fmicb.2019.02470
Abstract: The new era of multidrug resistance of pathogens against frontline antibiotics has compromised the immense therapeutic gains of the ‘golden age,’ stimulating a resurgence in antimicrobial research focused on antimicrobial and immunomodulatory components of botanical,… read more here.
Keywords: antimicrobial immunomodulatory; bioavailability; mechanism action; activity ... See more keywords
Antimicrobial and Immunomodulatory Effects of Selected Chemokine and Antimicrobial Peptide on Cytokine Profile during Salmonella Typhimurium Infection in Mouse
Sign Up to like & getrecommendations! Published in 2022 at "Antibiotics"
DOI: 10.3390/antibiotics11050607
Abstract: The antimicrobial and immunomodulatory capacities of the peptide Css54 and the chemokine MCP-1 were tested. The first, a peptide isolated from the venom of the scorpion Centruroides suffusus suffusus was synthesized chemically. In contrast, the… read more here.
Keywords: antimicrobial immunomodulatory; salmonella typhimurium; infection; salmonella ... See more keywords
Synthetic Antimicrobial Immunomodulatory Peptides: Ongoing Studies and Clinical Trials
Sign Up to like & getrecommendations! Published in 2022 at "Antibiotics"
DOI: 10.3390/antibiotics11081062
Abstract: The increasingly widespread antimicrobial resistance forces the search for new antimicrobial substances capable of fighting infection. Antimicrobial peptides (AMPs) and their synthetic analogs form an extensive group of compounds of great structural diversity and multifunctionality,… read more here.
Keywords: idr peptides; antimicrobial immunomodulatory; peptides ongoing; immunomodulatory peptides ... See more keywords
Antimicrobial and Immunomodulatory Properties and Applications of Marine-Derived Proteins and Peptides
Sign Up to like & getrecommendations! Published in 2019 at "Marine Drugs"
DOI: 10.3390/md17060350
Abstract: Marine organisms provide an abundant source of potential medicines. Many of the marine-derived biomaterials have been shown to act as different mechanisms in immune responses, and in each case they can significantly control the immune… read more here.
Keywords: immunomodulatory properties; derived proteins; proteins peptides; antimicrobial immunomodulatory ... See more keywords
Contribution of Aldehydes and Their Derivatives to Antimicrobial and Immunomodulatory Activities
Sign Up to like & getrecommendations! Published in 2022 at "Molecules"
DOI: 10.3390/molecules27113589
Abstract: Essential oils (EOs) are intricate combinations of evaporative compounds produced by aromatic plants and extracted by distillation or expression. EOs are natural secondary metabolites derived from plants and have been found to be useful in… read more here.
Keywords: immunomodulatory activities; antimicrobial immunomodulatory; contribution aldehydes; aldehydes derivatives ... See more keywords
Emerging Antimicrobial and Immunomodulatory Fiber-Based Scaffolding Systems for Treating Diabetic Foot Ulcers
Sign Up to like & getrecommendations! Published in 2023 at "Pharmaceutics"
DOI: 10.3390/pharmaceutics15010258
Abstract: Diabetic foot ulcers (DFUs) are one of the main complications of diabetes and are characterized by their complexity and severity, which are frequently aggravated by overexpressed inflammatory factors and polymicrobial infections. Most dressing systems offer… read more here.
Keywords: antimicrobial immunomodulatory; fiber based; diabetic foot; foot ulcers ... See more keywords