Cyanobacterial peptides as a prototype for the design of cathepsin D inhibitors
Sign Up to like & getrecommendations! Published in 2017 at "Journal of Peptide Science"
DOI: 10.1002/psc.3014
Abstract: Cathepsin D (Cath D) is overexpressed and secreted in a number of solid tumors and involved in the progress of tumor invasion, proliferation, metastasis, and apoptosis. Inhibition of Cath D is regarded as an attractive… read more here.
Keywords: cyanobacterial peptides; cathepsin; cath; peptides prototype ... See more keywords
Induced expression of cathelicidins in trout (Oncorhynchus mykiss) challenged with four different bacterial pathogens
Sign Up to like & getrecommendations! Published in 2018 at "Journal of Peptide Science"
DOI: 10.1002/psc.3089
Abstract: Cathelicidins are an important family of antimicrobial peptide effectors of innate immunity in vertebrates. Two members of this group, CATH‐1 and CATH‐2, have been identified and characterized in teleosts (ray‐finned fish). In this study, we… read more here.
Keywords: cath; induced expression; expression; expression cathelicidins ... See more keywords
Accuracy of Swan‒Ganz catheterization‐based assessment of right ventricular function: Validation study using high‐fidelity micromanometry‐derived values as reference
Sign Up to like & getrecommendations! Published in 2022 at "Pulmonary Circulation"
DOI: 10.1002/pul2.12078
Abstract: Abstract Right ventricular (RV) function critically affects the outcomes of patients with pulmonary hypertension (PH). Pressure wave analysis using Swan‒Ganz catheterization (SG‐cath) allows for the calculation of indices of RV function. However, the accuracy of… read more here.
Keywords: micromanometry derived; cath; pressure; right ventricular ... See more keywords
Chicken cathelicidin-2 promotes IL-1β secretion via the NLRP3 inflammasome pathway and serine proteases activity in LPS-primed murine neutrophils.
Sign Up to like & getrecommendations! Published in 2022 at "Developmental and comparative immunology"
DOI: 10.1016/j.dci.2022.104377
Abstract: Cathelicidins have antimicrobial and immunomodulatory activities. Previous studies have shown that chicken cathelicidin-2 (CATH-2) exerts strong anti-inflammatory activity through LPS neutralization. However, it is still unclear whether other intracellular signaling pathways are involved in CATH-2… read more here.
Keywords: nlrp3 inflammasome; lps primed; secretion; activity ... See more keywords
To Cath or Not to Cath: Pediatric Lung Transplant Candidates without a Diagnosis of Pulmonary Hypertension
Sign Up to like & getrecommendations! Published in 2021 at "Journal of Heart and Lung Transplantation"
DOI: 10.1016/j.healun.2021.01.992
Abstract: Purpose The purpose of this study is to investigate whether performing cardiac catheterization (cath) in pediatric lung transplantation (LTx) candidates without a diagnosis of pulmonary hypertension (PHTN) impacts listing outcomes. Methods The UNOS Registry was… read more here.
Keywords: diagnosis; cath; without diagnosis; pediatric lung ... See more keywords
A Frog-Derived Cathelicidin Peptide with Dual Antimicrobial and Immunomodulatory Activities Effectively Ameliorates Staphylococcus aureus-Induced Peritonitis in Mice.
Sign Up to like & getrecommendations! Published in 2022 at "ACS infectious diseases"
DOI: 10.1021/acsinfecdis.2c00260
Abstract: As antimicrobial resistance poses an increasing threat to public health, it is urgent to develop new antimicrobial agents. In this paper, we identify a novel 30-residue peptide (Nv-CATH, NCNFLCKVKQRLRSVSSTSHIGMAIPRPRG) from the skin of the frog… read more here.
Keywords: antimicrobial immunomodulatory; staphylococcus aureus; cath; mice ... See more keywords
Abstract TMP67: Prehospital Cath Lab Activation Based on EMS Large Vessel Occlusion Screen Cancelled
Sign Up to like & getrecommendations! Published in 2020 at "Stroke"
DOI: 10.1161/str.51.suppl_1.tmp67
Abstract: Background: Current guidelines indicate reduced time to reperfusion with thrombectomy is strongly associated with better outcomes. Validated screening tools for large vessel occlusions are available for the prehospital setting. Objective: To reduce door to access… read more here.
Keywords: cath; cath lab; large vessel; stat positive ... See more keywords
In vitro Impact of Yeast Expressed Hybrid Peptide CATH-2TP5 as a Prophylactic Measure Toward Sepsis and Inflammation
Sign Up to like & getrecommendations! Published in 2020 at "Frontiers in Bioengineering and Biotechnology"
DOI: 10.3389/fbioe.2020.00454
Abstract: CATH-2TP5 is a linear cationic hybrid peptide, consequent from naturally occurring antimicrobial peptide (AMPs) Cathelicidin-2 (CATH-2) and Immunomodulatory peptide Thymopentin (TP5) having dynamic and potent anti-inflammatory activities without hemolytic effect. The biocompatible mechanism of CATH-2TP5… read more here.
Keywords: peptide cath; cath 2tp5; vitro impact; cath ... See more keywords
Synergistic Antimicrobial Effect of Antimicrobial Peptides CATH-1, CATH-3, and PMAP-36 With Erythromycin Against Bacterial Pathogens
Sign Up to like & getrecommendations! Published in 2022 at "Frontiers in Microbiology"
DOI: 10.3389/fmicb.2022.953720
Abstract: With the increasing bacterial resistance to traditional antibiotics, there is an urgent need for the development of alternative drugs or adjuvants of antibiotics to enhance antibacterial efficiency. The combination of antimicrobial peptides (AMPs) and traditional… read more here.
Keywords: effect; combination; cath pmap; cath ... See more keywords
A Recombinant Snake Cathelicidin Derivative Peptide: Antibiofilm Properties and Expression in Escherichia coli
Sign Up to like & getrecommendations! Published in 2018 at "Biomolecules"
DOI: 10.3390/biom8040118
Abstract: The emergence of antimicrobial resistance among pathogenic microorganisms has been led to an urgent need for antibiotic alternatives. Antimicrobial peptides (AMPs) have been introduced as promising therapeutic agents because of their remarkable potentials. A new… read more here.
Keywords: peptide; recombinant snake; escherichia coli; cath ... See more keywords
Transcriptional Reprogramming of Autographa Californica Multiple Nucleopolyhedrovirus Chitinase and Cathepsin Genes Enhances Virulence
Sign Up to like & getrecommendations! Published in 2023 at "Viruses"
DOI: 10.3390/v15020503
Abstract: The baculoviral chitinase (CHIA) and cathepsin (V-CATH) enzymes promote terminal insect host liquefaction, which aids viral progeny dissemination. Recombinant Autographa californica nucleopolyhedrovirus (AcMNPV)-derived viruses were previously generated with reprogrammed chiA transcription by replacing the native… read more here.
Keywords: chitinase; cath; autographa californica; cathepsin ... See more keywords