LAUSR

About LAUSR
Donate
Contact Us

Follow us:

You are not signed in:

Sign Up!


   Articles with "cath" as a keyword



Cyanobacterial peptides as a prototype for the design of cathepsin D inhibitors

Sign Up to like & get
recommendations! Published in 2017 at "Journal of Peptide Science"

DOI: 10.1002/psc.3014

Abstract: Cathepsin D (Cath D) is overexpressed and secreted in a number of solid tumors and involved in the progress of tumor invasion, proliferation, metastasis, and apoptosis. Inhibition of Cath D is regarded as an attractive… read more here.

Keywords: cyanobacterial peptides; cathepsin; cath; peptides prototype ... See more keywords
Photo by bermixstudio from unsplash

Induced expression of cathelicidins in trout (Oncorhynchus mykiss) challenged with four different bacterial pathogens

Sign Up to like & get
recommendations! Published in 2018 at "Journal of Peptide Science"

DOI: 10.1002/psc.3089

Abstract: Cathelicidins are an important family of antimicrobial peptide effectors of innate immunity in vertebrates. Two members of this group, CATH‐1 and CATH‐2, have been identified and characterized in teleosts (ray‐finned fish). In this study, we… read more here.

Keywords: cath; induced expression; expression; expression cathelicidins ... See more keywords

Accuracy of Swan‒Ganz catheterization‐based assessment of right ventricular function: Validation study using high‐fidelity micromanometry‐derived values as reference

Sign Up to like & get
recommendations! Published in 2022 at "Pulmonary Circulation"

DOI: 10.1002/pul2.12078

Abstract: Abstract Right ventricular (RV) function critically affects the outcomes of patients with pulmonary hypertension (PH). Pressure wave analysis using Swan‒Ganz catheterization (SG‐cath) allows for the calculation of indices of RV function. However, the accuracy of… read more here.

Keywords: micromanometry derived; cath; pressure; right ventricular ... See more keywords

Chicken cathelicidin-2 promotes IL-1β secretion via the NLRP3 inflammasome pathway and serine proteases activity in LPS-primed murine neutrophils.

Sign Up to like & get
recommendations! Published in 2022 at "Developmental and comparative immunology"

DOI: 10.1016/j.dci.2022.104377

Abstract: Cathelicidins have antimicrobial and immunomodulatory activities. Previous studies have shown that chicken cathelicidin-2 (CATH-2) exerts strong anti-inflammatory activity through LPS neutralization. However, it is still unclear whether other intracellular signaling pathways are involved in CATH-2… read more here.

Keywords: nlrp3 inflammasome; lps primed; secretion; activity ... See more keywords
Photo from wikipedia

To Cath or Not to Cath: Pediatric Lung Transplant Candidates without a Diagnosis of Pulmonary Hypertension

Sign Up to like & get
recommendations! Published in 2021 at "Journal of Heart and Lung Transplantation"

DOI: 10.1016/j.healun.2021.01.992

Abstract: Purpose The purpose of this study is to investigate whether performing cardiac catheterization (cath) in pediatric lung transplantation (LTx) candidates without a diagnosis of pulmonary hypertension (PHTN) impacts listing outcomes. Methods The UNOS Registry was… read more here.

Keywords: diagnosis; cath; without diagnosis; pediatric lung ... See more keywords

A Nonbactericidal Anionic Antimicrobial Peptide Provides Prophylactic and Therapeutic Efficacies against Bacterial Infections in Mice by Immunomodulatory-Antithrombotic Duality.

Sign Up to like & get
recommendations! Published in 2024 at "Journal of medicinal chemistry"

DOI: 10.1021/acs.jmedchem.4c00342

Abstract: Although bactericidal cationic antimicrobial peptides (AMPs) have been well characterized, less information is available about the antibacterial properties and mechanisms of action of nonbactericidal AMPs, especially nonbactericidal anionic AMPs. Herein, a novel anionic antimicrobial peptide… read more here.

Keywords: antimicrobial peptide; nonbactericidal anionic; peptide provides; anionic antimicrobial ... See more keywords

A Frog-Derived Cathelicidin Peptide with Dual Antimicrobial and Immunomodulatory Activities Effectively Ameliorates Staphylococcus aureus-Induced Peritonitis in Mice.

Sign Up to like & get
recommendations! Published in 2022 at "ACS infectious diseases"

DOI: 10.1021/acsinfecdis.2c00260

Abstract: As antimicrobial resistance poses an increasing threat to public health, it is urgent to develop new antimicrobial agents. In this paper, we identify a novel 30-residue peptide (Nv-CATH, NCNFLCKVKQRLRSVSSTSHIGMAIPRPRG) from the skin of the frog… read more here.

Keywords: antimicrobial immunomodulatory; staphylococcus aureus; cath; mice ... See more keywords

To Investigate the Antibacterial and Antibiofilm Activity of the Antimicrobial Peptide FP-CATH against Carbapenem-Resistant Klebsiella pneumoniae

Sign Up to like & get
recommendations! Published in 2025 at "ACS Omega"

DOI: 10.1021/acsomega.5c05443

Abstract: In light of the increasing prevalence of carbapenem-resistant Klebsiella pneumoniae (CRKP), which represents a significant public health threat, it is imperative to investigate novel therapeutic strategies. This study aims to assess the efficacy of the… read more here.

Keywords: klebsiella pneumoniae; resistant klebsiella; carbapenem; cath ... See more keywords

Abstract TMP67: Prehospital Cath Lab Activation Based on EMS Large Vessel Occlusion Screen Cancelled

Sign Up to like & get
recommendations! Published in 2020 at "Stroke"

DOI: 10.1161/str.51.suppl_1.tmp67

Abstract: Background: Current guidelines indicate reduced time to reperfusion with thrombectomy is strongly associated with better outcomes. Validated screening tools for large vessel occlusions are available for the prehospital setting. Objective: To reduce door to access… read more here.

Keywords: cath; cath lab; large vessel; stat positive ... See more keywords

Bactericidal activities and biochemical features of 16 antimicrobial peptides against bovine-mastitis causative pathogens

Sign Up to like & get
recommendations! Published in 2024 at "Veterinary Research"

DOI: 10.1186/s13567-024-01402-x

Abstract: Mastitis, often caused by bacterial infection, is an inflammatory condition affecting the mammary glands. The condition is particularly prevalent in dairy cattle. Current treatment of bovine mastitis heavily relies on the use of antibiotics. To… read more here.

Keywords: bovine mastitis; mastitis; mastitis causative; cath ... See more keywords

In vitro Impact of Yeast Expressed Hybrid Peptide CATH-2TP5 as a Prophylactic Measure Toward Sepsis and Inflammation

Sign Up to like & get
recommendations! Published in 2020 at "Frontiers in Bioengineering and Biotechnology"

DOI: 10.3389/fbioe.2020.00454

Abstract: CATH-2TP5 is a linear cationic hybrid peptide, consequent from naturally occurring antimicrobial peptide (AMPs) Cathelicidin-2 (CATH-2) and Immunomodulatory peptide Thymopentin (TP5) having dynamic and potent anti-inflammatory activities without hemolytic effect. The biocompatible mechanism of CATH-2TP5… read more here.

Keywords: peptide cath; cath 2tp5; vitro impact; cath ... See more keywords