A Frog-Derived Cathelicidin Peptide with Dual Antimicrobial and Immunomodulatory Activities Effectively Ameliorates Staphylococcus aureus-Induced Peritonitis in Mice.
Sign Up to like & getrecommendations! Published in 2022 at "ACS infectious diseases"
DOI: 10.1021/acsinfecdis.2c00260
Abstract: As antimicrobial resistance poses an increasing threat to public health, it is urgent to develop new antimicrobial agents. In this paper, we identify a novel 30-residue peptide (Nv-CATH, NCNFLCKVKQRLRSVSSTSHIGMAIPRPRG) from the skin of the frog… read more here.
Keywords: antimicrobial immunomodulatory; staphylococcus aureus; cath; mice ... See more keywords